PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 150aa    MW: 16944 Da    PI: 8.5066
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004051.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.32.8e-1251106358
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                 + +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L + l++    ++ 
  Do004051.1  51 DERRRRRMVSNRESARRSRMRKQRQLTELWAQVVHLRGTNRRLLDDLNRAMRGCSD 106
                 5679999***************************************9998877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.6E-949100No hitNo description
SMARTSM003382.1E-1349113IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.86451102IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.14E-1053101No hitNo description
PfamPF001701.5E-953107IPR004827Basic-leucine zipper domain
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
CDDcd147022.97E-1358102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MIAMPPTPFH FSPSTFEPIH ETPAIIGNSP GGSGSADDAY AYGGRMAMAE DERRRRRMVS  60
NRESARRSRM RKQRQLTELW AQVVHLRGTN RRLLDDLNRA MRGCSDMCCE NAQLEKEKAE  120
LSTKLERLMQ AQNATTPSSS SEPRDDNSTE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16572RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277091e-110KJ727709.1 Zea mays clone pUT5648 bZIP transcription factor (bZIP82) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957101.12e-86PREDICTED: basic leucine zipper 43-like
TrEMBLK3ZXA62e-86K3ZXA6_SETIT; Uncharacterized protein
STRINGSi031238m6e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-12basic leucine-zipper 42